PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g00925.1.p
Common NameBRADI_4g00925
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family FAR1
Protein Properties Length: 68aa    MW: 7829.63 Da    PI: 3.9731
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g00925.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR122.24.5e-072859132
              FAR1  1 kfYneYAkevGFsvrkskskkskrngeitkrt 32
                      +fYn+YA e GFsvrks+ +  + n+ei+ r+
  Bradi4g00925.1.p 28 DFYNSYALEKGFSVRKSYVEWDEANQEIILRK 59
                      6******************9999999998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.5E-52859IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MEDMVDESVD EYLDIVGKTF GSEDDGFDFY NSYALEKGFS VRKSYVEWDE ANQEIILRKM  60
GGFLRKD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231784.23e-28PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_014751141.12e-28PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLA0A0Q3P9N68e-42A0A0Q3P9N6_BRADI; Uncharacterized protein
STRINGBRADI4G00925.14e-39(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2449976
Representative plantOGRP1143425